PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.007G146500.1.p
Common NameSb07g022120, SORBIDRAFT_07g022120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 226aa    MW: 24239.2 Da    PI: 5.4228
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.007G146500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.81.6e-151662148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          + +WT+ Ede l +av+++G  +W++Ia  +  gR +k+c++rw ++l
  Sobic.007G146500.1.p 16 KTPWTEKEDEALRRAVREHGRQNWAAIAGAVA-GRGAKSCRLRWCQHL 62
                          579*****************************.***********9986 PP

2Myb_DNA-binding47.54.2e-1570111346
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                           ++T+eEd ++v++   +G++ W+tIar +  gR+++ +k+rw++
  Sobic.007G146500.1.p  70 PFTPEEDARIVELQGVHGNK-WATIARFLH-GRSDNAVKNRWNS 111
                           89******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.341166IPR017930Myb domain
SuperFamilySSF466891.64E-2914109IPR009057Homeodomain-like
SMARTSM007171.3E-151564IPR001005SANT/Myb domain
PfamPF002499.4E-151662IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-221869IPR009057Homeodomain-like
CDDcd001673.15E-141862No hitNo description
SMARTSM007178.3E-1267115IPR001005SANT/Myb domain
PROSITE profilePS5129417.31369117IPR017930Myb domain
PfamPF002491.8E-1270111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2170115IPR009057Homeodomain-like
CDDcd001676.61E-1070110No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MAAAQCGEGK AADCKKTPWT EKEDEALRRA VREHGRQNWA AIAGAVAGRG AKSCRLRWCQ  60
HLAPELDSRP FTPEEDARIV ELQGVHGNKW ATIARFLHGR SDNAVKNRWN SALRKMHQQG  120
YYPAAVAAAA EDDAEDTDGQ AAEAVVCLDL FPLRARAMGE ATAADRLVVR EEEVEGEGDV  180
AVEPIGLGLK LGSPGLSDAE LELSLGPVRP SSSNRGEAAS FRLCL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-27131154106B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126166e-90CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002444450.11e-163hypothetical protein SORBIDRAFT_07g022120
TrEMBLC5YLR91e-163C5YLR9_SORBI; Putative uncharacterized protein Sb07g022120
STRINGSb07g022120.11e-162(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49603465
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.11e-36myb domain protein 77